PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.109320.2
Common NameCsa_2G249860, LOC101205137
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 682aa    MW: 74908 Da    PI: 6.4723
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.109320.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-094254621954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  Cucsa.109320.2 425 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 462
                     664559******************************88 PP

2BELL124.54.3e-40287358172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e+q+lq+k +kLl +l+eVd+rY+qy++q+q+v+ssF+++ag+g++kpYt+lAl++iSrhFrcL+daia+q+
  Cucsa.109320.2 287 EKQDLQNKLTKLLYMLDEVDRRYNQYYHQMQIVVSSFDVIAGCGASKPYTALALQTISRHFRCLRDAIAGQV 358
                     6899*****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-58201356IPR006563POX domain
PfamPF075268.5E-51207355IPR006563POX domain
PROSITE profilePS5007112.212403466IPR001356Homeobox domain
SMARTSM003891.0E-9406470IPR001356Homeobox domain
CDDcd000865.64E-13406467No hitNo description
SuperFamilySSF466892.4E-17407474IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-29409472IPR009057Homeodomain-like
PfamPF059204.6E-18423462IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MATYFSSSNN ERDTTPILYS RGSLLGSYEE TTILPRNMMM HVNSGTYMDS LPSQAQNGCG  60
QITSVGAAGT TQQQQEFLSN LGGSQIAEHD FNTWREDRSE MLGANSMRGP TNVLHGGQNL  120
QGQGLSLTLS TQIPSAIQIP SIPYRNSDMG LTSFLSPNPT NSGEDGCRNG ASRDEQLRNG  180
ENLPPNFQEL AKGEISQYSM STIARTMPNS KYLKAAQQLL DEVVNVRKAL KRPNNDRNQS  240
SHEHETRSAK NGDTGTKNDS SMLTASGTSS NPQETGSNST CELSHAEKQD LQNKLTKLLY  300
MLDEVDRRYN QYYHQMQIVV SSFDVIAGCG ASKPYTALAL QTISRHFRCL RDAIAGQVRA  360
TRKSLGEHEN SGSDKGVGIT RLRYVDQQLR QQRALQQLGM IQQHAWRPQR GLPENSVSIL  420
RAWLFEHFLH PYPKDSDKIM LARQTGLTRS QVSNWFINAR VRLWKPMVEE MYKEEIGSVD  480
MDSISSSENA GKATKGDNKT FDDDKEEDLQ QSASSTATER CSAGDIIDLK SDQVSNLGNS  540
CSNRVASFQN GAHIEARNEL AKPNDELRPN VNNSSFFPDA IVHSQGESDR FMAAAAAYHM  600
SELGRFGTVG GVSLTLGLQH CEGGGLPLPA GTHHGFAAMR GDDMYNAAAS SLGETVHFEC  660
VNSGNPQPRF GPSHLYHDFV V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16412469158Homeobox protein Meis1
4xrs_B1e-16412469158Homeobox protein Meis1
5bng_A2e-16412470159Homeobox protein Meis2
5bng_B2e-16412470159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819120.0LN681912.1 Cucumis melo genomic scaffold, anchoredscaffold00059.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011649247.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011649248.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A0A0LPC40.0A0A0A0LPC4_CUCSA; Uncharacterized protein
STRINGVIT_03s0038g00050.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-118BEL1-like homeodomain 6
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]